CASP1 Antibody - C-terminal region : FITC

CASP1 Antibody - C-terminal region : FITC
SKU
AVIARP58984_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CASP1

Molecular Weight: 28 kDa

Peptide Sequence: Synthetic peptide located within the following region: MLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIGRLIEHMQEYA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: caspase-1

Protein Size: 263

Purification: Affinity purified
More Information
SKU AVIARP58984_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58984_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 834
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×