CASP4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP4

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: GILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Caspase-4

Protein Size: 377

Purification: Affinity Purified

• SKU: AVIARP58990_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58990_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 837
• Host: Rabbit
• Conjugate: Conjugated, HRP