CASP7 Antibody - N-terminal region : FITC

CASP7 Antibody - N-terminal region : FITC
SKU
AVIARP58995_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of this caspase is cleaved by caspase 3 and 10. It is activated upon cell death stimuli and induces apoptosis. Alternative splicing results in four transcript variants, encoding three distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CASP7

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: NNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-7

Protein Size: 336

Purification: Affinity Purified
More Information
SKU AVIARP58995_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58995_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 840
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×