CASP8 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. This protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP8

Molecular Weight: 59 kDa

Peptide Sequence: Synthetic peptide located within the following region: SPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: caspase-8

Protein Size: 538

Purification: Affinity purified

• SKU: AVIARP58883_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58883_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 841
• Host: Rabbit
• Conjugate: Conjugated, FITC