CCDC54 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of CCDC54 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC54

Key Reference: Dadabayev,A.R., (2005) Am. J. Hematol. 80 (1), 6-11

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 54

Protein Size: 328

Purification: Affinity Purified

• SKU: AVIARP58605_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58605_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84692
• Host: Rabbit
• Conjugate: Conjugated, HRP