Ccnb1ip1 Antibody - N-terminal region : Biotin

Ccnb1ip1 Antibody - N-terminal region : Biotin
SKU
AVIARP58439_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ccnb1ip1

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: CEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MCG50291 EMBL EDL20823.1

Protein Size: 276

Purification: Affinity Purified
More Information
SKU AVIARP58439_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58439_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 239083
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×