CD28 Antibody - C-terminal region : Biotin

CD28 Antibody - C-terminal region : Biotin
SKU
AVIARP59096_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CD28 is involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD28

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell-specific surface glycoprotein CD28

Protein Size: 220

Purification: Affinity Purified
More Information
SKU AVIARP59096_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59096_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 940
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×