CD38 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD38

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosyl cyclase 1

Protein Size: 300

Purification: Affinity Purified

• SKU: AVIARP59103_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59103_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 952
• Host: Rabbit
• Conjugate: Conjugated, HRP