CD3E Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD3E

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-cell surface glycoprotein CD3 epsilon chain

Protein Size: 207

Purification: Affinity Purified

• SKU: AVIARP59097_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59097_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 916
• Host: Rabbit
• Conjugate: Conjugated, HRP