CD7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq]

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD7

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell antigen CD7

Protein Size: 240

Purification: Affinity Purified

• SKU: AVIARP59112_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59112_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 924
• Host: Rabbit
• Conjugate: Conjugated, FITC