CDKL2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDKL2

Key Reference: Marracci,G.H., (2006) Biochem. Biophys. Res. Commun. 344 (3), 963-971

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase-like 2

Protein Size: 493

Purification: Affinity Purified

• SKU: AVIARP58606_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58606_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8999
• Host: Rabbit
• Conjugate: Conjugated, FITC