CEP70 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CEP70 plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, it is required for the organization and orientation of the mitotic spindle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP70

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centrosomal protein of 70 kDa

Protein Size: 212

Purification: Affinity Purified

• SKU: AVIARP58607_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58607_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 80321
• Host: Rabbit
• Conjugate: Conjugated, FITC