CHCHD8 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of CHCHD8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHCHD8

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome c oxidase assembly factor 4 homolog, mitochondrial

Protein Size: 87

Purification: Affinity Purified

• SKU: AVIARP56948_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56948_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51287
• Host: Rabbit