CHMP4C antibody

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

Calculated MW: 26

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the C-terminal region of Mouse Chmp4c: SEAFSQRVQFADGFDEAELLAELEELEQEELNKKMTSLELPNVPSSSLPA

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

• SKU: GTX04627-100
• Manufacturer: GeneTex
• Manufacturer SKU: GTX04627-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 66371
• Host: Rabbit
• Conjugate: Unconjugated