CPE Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteinsThis gene encodes a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins. Mutations in this gene are implicated in type II diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CPE

Key Reference: Wang,J., (2008) Acta Pharmacol. Sin. 29 (6), 736-744

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carboxypeptidase E

Protein Size: 476

Purification: Affinity Purified

• SKU: AVIARP58445_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58445_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 1363
• Host: Rabbit
• Conjugate: Conjugated, Biotin