CRYL1 Antibody - N-terminal region : FITC

CRYL1 Antibody - N-terminal region : FITC
SKU
AVIARP58609_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CRYL1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: CVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lambda-crystallin homolog

Protein Size: 319

Purification: Affinity Purified
More Information
SKU AVIARP58609_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58609_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51084
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×