CST11 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CST11 has antibacterial activity against the Gram-negative bacteria E.coli. It may play a role in sperm maturation and fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CST11

Key Reference: N/A

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: KTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRVLKVQRQVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cystatin-11

Protein Size: 138

Purification: Affinity purified

• SKU: AVIARP58448_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58448_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 140880
• Host: Rabbit
• Conjugate: Conjugated, HRP