Cxxc5 Antibody - N-terminal region : HRP

Cxxc5 Antibody - N-terminal region : HRP
SKU
AVIARP58792_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cxxc5 may indirectly participate in activation of the NF-kappa-B and MAPK pathways. It acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Cxxc5 is also required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest and is involved in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cxxc5

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CXXC-type zinc finger protein 5

Protein Size: 317

Purification: Affinity Purified
More Information
SKU AVIARP58792_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58792_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 67393
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×