CYP4X1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4X1

Key Reference: Savas,U., (2005) Arch. Biochem. Biophys. 436 (2), 377-385

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 4X1

Protein Size: 509

Purification: Affinity Purified

• SKU: AVIARP55763_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55763_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 260293
• Host: Rabbit