DDAH2 Antibody - N-terminal region : Biotin

DDAH2 Antibody - N-terminal region : Biotin
SKU
AVIARP58611_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2

Key Reference: Kim,Y.J., (2008) Twin Res Hum Genet 11 (1), 77-83

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

Protein Size: 285

Purification: Affinity Purified
More Information
SKU AVIARP58611_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58611_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 23564
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×