DMTN Antibody - C-terminal region : FITC

DMTN Antibody - C-terminal region : FITC
SKU
AVIARP58695_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Dematin, or EPB49, is an actin-bundling protein originally identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase and is restored after dephosphorylation.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DMTN

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dematin

Protein Size: 383

Purification: Affinity Purified
More Information
SKU AVIARP58695_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58695_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2039
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×