DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)

Specificity: This monoclonal antibody recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations.
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).

• SKU: SCYRA0364-C.1
• Manufacturer: ScyTek Laboratories
• Manufacturer SKU: RA0364-C.1
• Package Unit: 0,1 ml
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1
• Host: Mouse