DPPA3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that in mice may function as a maternal factor during the preimplantation stage of development. In mice, this gene may play a role in transcriptional repression, cell division, and maintenance of cell pluripotentiality. In humans, related intronless loci are located on chromosomes 14 and X.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DPPA3

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Developmental pluripotency-associated protein 3

Protein Size: 159

Purification: Affinity Purified

• SKU: AVIARP58824_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58824_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 359787
• Host: Rabbit
• Conjugate: Conjugated, FITC