DRAM Antibody - N-terminal region : Biotin

DRAM Antibody - N-terminal region : Biotin
SKU
AVIARP58891_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DRAM

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA damage-regulated autophagy modulator protein 1

Protein Size: 238

Purification: Affinity Purified
More Information
SKU AVIARP58891_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58891_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55332
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×