EFHD2 Antibody - N-terminal region : HRP

EFHD2 Antibody - N-terminal region : HRP
SKU
AVIARP58617_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHD2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EF-hand domain-containing protein D2

Protein Size: 240

Purification: Affinity Purified
More Information
SKU AVIARP58617_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58617_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish, Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79180
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×