EGR1 Antibody - middle region : Biotin

EGR1 Antibody - middle region : Biotin
SKU
AVIARP58382_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a tr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EGR1

Key Reference: Akutagawa,O., (2008) Cancer Sci. 99 (7), 1401-1406

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Early growth response protein 1

Protein Size: 543

Purification: Affinity Purified
More Information
SKU AVIARP58382_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58382_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1958
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×