EIF2C4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF2C4

Key Reference: Tao,W.A., (2005) Nat. Methods 2 (8), 591-598

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein argonaute-4

Protein Size: 861

Purification: Affinity Purified

• SKU: AVIARP58795_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58795_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 192670
• Host: Rabbit
• Conjugate: Conjugated, HRP