Eif4e Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Eif4e binds to the mRNA 7-methylguanosine cap and mediates mRNA binding to the 40S ribosome in the rate limiting step in translational initiation.

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eukaryotic translation initiation factor 4E

Protein Size: 217

Purification: Affinity Purified

• SKU: AVIARP58894_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58894_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 117045
• Host: Rabbit
• Conjugate: Conjugated, HRP