EIF4E2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 4E type 2

Protein Size: 245

Purification: Affinity Purified

• SKU: AVIARP58897_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58897_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9470
• Host: Rabbit
• Conjugate: Conjugated, Biotin