ENOPH1 Antibody - N-terminal region : Biotin

ENOPH1 Antibody - N-terminal region : Biotin
SKU
AVIARP57529_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOPH1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Enolase-phosphatase E1

Protein Size: 261

Purification: Affinity Purified
More Information
SKU AVIARP57529_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57529_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58478
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×