EVI1 Antibody - middle region : HRP

EVI1 Antibody - middle region : HRP
SKU
AVIARP58566_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EVI1

Molecular Weight: 118kDa

Peptide Sequence: Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MDS1 and EVI1 complex locus protein EVI1

Protein Size: 1051

Purification: Affinity Purified
More Information
SKU AVIARP58566_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58566_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2122
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×