FLJ14803 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FLJ14803 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ14803

Key Reference: Yamada,T., (2004) Genomics 83 (3), 402-412

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane protein 209

Protein Size: 561

Purification: Affinity Purified

• SKU: AVIARP58694_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58694_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84928
• Host: Rabbit
• Conjugate: Conjugated, HRP