FLJ20433 Antibody - N-terminal region : Biotin

FLJ20433 Antibody - N-terminal region : Biotin
SKU
AVIARP58623_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of FLJ20433 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable exonuclease mut-7 homolog

Protein Size: 758

Purification: Affinity Purified
More Information
SKU AVIARP58623_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58623_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Goat (Caprine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54932
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×