FLJ20433 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FLJ20433 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Probable exonuclease mut-7 homolog

Protein Size: 758

Purification: Affinity Purified

• SKU: AVIARP58623_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58623_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Goat (Caprine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54932
• Host: Rabbit
• Conjugate: Conjugated, HRP