Frs3 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Frs3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. It is involved in the activation of MAP kinases. Frs3 Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Frs3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: APGPTPHPVRSSDSYAVIDLKKTAAMSDLQRALPRDDGAVRKTRHNSTDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fibroblast growth factor receptor substrate 3

Protein Size: 492

Purification: Affinity Purified

• SKU: AVIARP58468_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58468_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 107971
• Host: Rabbit
• Conjugate: Conjugated, HRP