GIMAP6 Antibody - C-terminal region : HRP

GIMAP6 Antibody - C-terminal region : HRP
SKU
AVIARP56178_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GIMAP6

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTPase IMAP family member 6

Protein Size: 292

Purification: Affinity Purified
More Information
SKU AVIARP56178_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56178_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 474344
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×