GLRX3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GLRX3 may play a role in regulating the function of the thioredoxin system.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutaredoxin-3

Protein Size: 335

Purification: Affinity Purified

• SKU: AVIARP58626_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58626_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10539
• Host: Rabbit
• Conjugate: Conjugated, HRP