GMFG Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GMFG

Key Reference: Shi,Y., (2006) Genomics Proteomics Bioinformatics 4 (3), 145-155

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glia maturation factor gamma

Protein Size: 142

Purification: Affinity Purified

• SKU: AVIARP58771_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58771_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9535
• Host: Rabbit
• Conjugate: Conjugated, Biotin