GNL3L Antibody - N-terminal region : FITC

GNL3L Antibody - N-terminal region : FITC
SKU
AVIARP58798_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L

Key Reference: Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein-like 3-like protein

Protein Size: 582

Purification: Affinity Purified
More Information
SKU AVIARP58798_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58798_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 54552
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×