GNL3L Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L

Key Reference: Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein-like 3-like protein

Protein Size: 582

Purification: Affinity Purified

• SKU: AVIARP58799_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58799_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Immunofluorescence, Western Blotting
• Human Gene ID: 54552
• Host: Rabbit
• Conjugate: Conjugated, FITC