GNL3L Antibody - N-terminal region : HRP

GNL3L Antibody - N-terminal region : HRP
SKU
AVIARP58798_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L

Key Reference: Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein-like 3-like protein

Protein Size: 582

Purification: Affinity Purified
More Information
SKU AVIARP58798_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58798_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 54552
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×