HAVCR2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAVCR2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hepatitis A virus cellular receptor 2

Protein Size: 301

Purification: Affinity Purified

• SKU: AVIARP59159_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59159_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84868
• Host: Rabbit
• Conjugate: Conjugated, HRP