hCG_1745121 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of hCG_1745121 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_1745121

Key Reference: Venter,J.C., (2001) Science 291 (5507), 1304-1351

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Isoprenoid synthase domain-containing protein

Protein Size: 401

Purification: Affinity Purified

• SKU: AVIARP58634_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58634_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 729920
• Host: Rabbit
• Conjugate: Conjugated, HRP