Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3
Amino Acid Sequence: MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFQAAVCTRGVAKAVDFIPVESMETTMRS
Applications: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Description: Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b (GenBank Accession No. AF054247) with Arg-to-Gln mutation on a.a. 155, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.3 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 335 mM imidazole, and 20% glycerol.
Genbank: AF054247
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal FLAG-His-tags
Uniprot: O92972
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Lin, C., et al., Hepatitis C Viruse. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6.
2. Lang Kuhs, K.A., et al., Mol. Ther. 2012 May;20(3):669-678.
3. Massariol, MJ., et al., Biochem Biophys Res Commun. 2010 Jan 1;391(1):692-697.
English
Deutsch
