HDDC3 Antibody - middle region : HRP

HDDC3 Antibody - middle region : HRP
SKU
AVIARP55898_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HDDC3

Key Reference: Zody,M.C., (2006) Nature 440 (7084), 671-675

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1

Protein Size: 140

Purification: Affinity Purified
More Information
SKU AVIARP55898_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55898_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 374659
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×