HLX Antibody - middle region : HRP

HLX Antibody - middle region : HRP
SKU
AVIARP58016_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HLX is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLX

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: H2.0-like homeobox protein

Protein Size: 488

Purification: Affinity Purified
More Information
SKU AVIARP58016_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58016_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3142
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×