HMGB1 Antibody - N-terminal region : FITC

HMGB1 Antibody - N-terminal region : FITC
SKU
AVIARP59013_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Extracellular HMGB1 is an activator of human tumor cell migration operating in concert with EGF. HMGB1 encodes a protein that is potentially involved in the regulation of lipogenic and cholesterogenic gene transcription.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: QTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: High mobility group protein B1

Protein Size: 215

Purification: Affinity Purified
More Information
SKU AVIARP59013_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59013_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3146
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×