Hmgcl Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Hmgcl is an enzyme of the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hmgcl

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxymethylglutaryl-CoA lyase, mitochondrial

Protein Size: 325

Purification: Affinity Purified

• SKU: AVIARP56278_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56278_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79238
• Host: Rabbit