Hmgn2 Antibody - N-terminal region : HRP

Hmgn2 Antibody - N-terminal region : HRP
SKU
AVIARP58365_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hmgn2 bind to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may be involved in the process which maintains transcribable genes in an unique chromatin conformation.

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Non-histone chromosomal protein HMG-17

Protein Size: 90

Purification: Affinity Purified
More Information
SKU AVIARP58365_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58365_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 15331
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×