HOXB5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HOXB5 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB5 gene is included in a cluster of homeobox B genes located on chromosome 17.The protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5

Key Reference: Wu,Q., (er) Mol. Cancer 6, 45 (2007)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: DPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-B5

Protein Size: 269

Purification: Affinity Purified

• SKU: AVIARP58022_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58022_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3215
• Host: Rabbit